PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00304g00107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 349aa    MW: 38826 Da    PI: 10.3478
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00304g00107.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72e-11102147247
                               SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               ++WT+eE+  ++ +  +lG+g+W+ I++   + Rt  q+ s+ qky
  Peaxi162Scf00304g00107.1 102 KPWTEEEHRSFLIGLDKLGKGDWRGISKNYVLSRTSTQVASHAQKY 147
                               58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.5651227IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.42496152IPR017930Myb domain
SuperFamilySSF466891.22E-1597152IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-1699150IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.4E-10100149IPR009057Homeodomain-like
SMARTSM007175.5E-8100150IPR001005SANT/Myb domain
PfamPF002494.7E-9102147IPR001005SANT/Myb domain
CDDcd001676.13E-7103148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MVSMSMTKKD ARKCSHCGHN GHNSRTCNNF KEVKLFGVRI DDNNNNNNNH HQGGDNKMKM  60
KFGDEFIRRS KSLGNLESAA TNDLYHGIDA GYFSDGPRKK GKPWTEEEHR SFLIGLDKLG  120
KGDWRGISKN YVLSRTSTQV ASHAQKYFNR ISTSNEKRKR RPSVFDVHLN DPNLQISSKA  180
STSLPSIPNN VPEVQKEASA PLEQLFETCK IKGQPTKIYK YLQATKTTPP ATCEKPPLSP  240
MSTRRFVVPD FRHIPSMMGS LSRNVDGLKA STKVTPTVSW YPVFNFPNPY QYAHILNPEG  300
ATFAPYVARP SSTGILSRQP PQVQSQAAIH APPVTNKDGL NISIGALGV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609815.11e-126PREDICTED: transcription factor MYB1R1-like isoform X1
RefseqXP_009778274.11e-126PREDICTED: transcription factor MYB1R1-like
RefseqXP_016481927.11e-126PREDICTED: transcription factor MYB1R1-like
TrEMBLK4C4M71e-115K4C4M7_SOLLC; Uncharacterized protein
STRINGSolyc06g034030.2.11e-115(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117831823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.14e-49MYB_related family protein